PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1081_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family HD-ZIP
Protein Properties Length: 305aa    MW: 34044.3 Da    PI: 8.1391
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1081_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-18133187256
                                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                          rk+ +++k+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  cra_locus_1081_iso_4_len_1269_ver_3 133 RKKLRLSKDQSAILEESFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTK 187
                                          788899***********************************************98 PP

2HD-ZIP_I/II129.81.1e-41133222191
                          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalk 74 
                                          +kk+rlsk+q+++LEesF+e+++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+
  cra_locus_1081_iso_4_len_1269_ver_3 133 RKKLRLSKDQSAILEESFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCESLT 206
                                          69************************************************************************ PP

                          HD-ZIP_I/II  75 eenerLekeveeLreel 91 
                                          een+rL+kev+eLr +l
  cra_locus_1081_iso_4_len_1269_ver_3 207 EENRRLQKEVQELR-AL 222
                                          *************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046187.3E-341107IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466891.46E-18122190IPR009057Homeodomain-like
PROSITE profilePS5007117.281129189IPR001356Homeobox domain
SMARTSM003893.0E-16131193IPR001356Homeobox domain
PfamPF000464.0E-16133187IPR001356Homeobox domain
CDDcd000866.70E-15133190No hitNo description
Gene3DG3DSA:1.10.10.608.3E-18138187IPR009057Homeodomain-like
PRINTSPR000313.1E-5160169IPR000047Helix-turn-helix motif
PROSITE patternPS000270164187IPR017970Homeobox, conserved site
PRINTSPR000313.1E-5169185IPR000047Helix-turn-helix motif
SMARTSM003408.7E-28189232IPR003106Leucine zipper, homeobox-associated
PfamPF021831.8E-11189223IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009641Biological Processshade avoidance
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009826Biological Processunidimensional cell growth
GO:0010016Biological Processshoot system morphogenesis
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010218Biological Processresponse to far red light
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MVEKEDLGLS LSLSFPEKQS TNTSSSSPLQ LNLMPSLAAS FLQQKTSWTE TFPSSDRNME  60
GCRVETRTFL KGIDVNRLPA ADAEEEAGVS SPNSTLSSIS GKRSEREANG DDNELERTSS  120
RGISDEEDGD TSRKKLRLSK DQSAILEESF KEHNTLNPKQ KLALAKRLGL RPRQVEVWFQ  180
NRRARTKLKQ TEVDCEYLKR CCESLTEENR RLQKEVQELR ALKLSPQFYM QMTPPTTLTM  240
CPSCERVAMP PSSSSSTAPT STTAVAHSMV PPHPHPRPIP FNPWATTTAA APIAHRPFDA  300
LHSRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131137SRKKLRL
2181189RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012070041.11e-158PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054661e-110HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLA0A068UN801e-173A0A068UN80_COFCA; Uncharacterized protein
STRINGVIT_00s0299g00100.t011e-155(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485